Cytochrome P450 2B6 (CYP2B6) Rabbit Polyclonal Antibody

CAT#: TA346223

Rabbit Polyclonal Anti-CYP2B6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name cytochrome P450 family 2 subfamily B member 6
Background This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]
Synonyms CPB6; CYP2B; CYP2B7; CYP2B7P; CYPIIB6; EFVM; IIB1; P450
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 92%; Pig: 82%; Guinea pig: 82%; Horse: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, P450
Protein Pathways Arachidonic acid metabolism, Drug metabolism - cytochrome P450, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...