KIAA0859 (METTL13) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA0859 antibody: synthetic peptide directed towards the C terminal of human KIAA0859. Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	methyltransferase like 13
Database Link	NP_001007240 Entrez Gene 51603 Human UniProt ID Q8N6R0
Background	The function remains unknown.
Synonyms	5630401D24Rik; CGI-01; feat; KIAA0859
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.