Eif3s12 (BC027638) Mouse Tagged ORF Clone

CAT#: MG201715

  • TrueORF®

Eif3s12 (tGFP-tagged) - Mouse eukaryotic translation initiation factor 3, subunit 12 (cDNA clone MGC:41262 IMAGE:1348838)

ORF Plasmid: DDK tGFP



  "BC027638" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2090.00


货期*
4周

规格
    • 10 ug

Product images

推荐一起购买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Eif3k Antibody - N-terminal region
    • 50 ug

CNY 4628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms eIF3K
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201715 representing BC027638
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGATGTTTGAGCAGATGAGAGCGAACGTGGGCAAGTTGCTCAAGGGTATCGACAGGTACCAGTTCA
ACCCAGCCTTCTTCCAGACCACAGTCACTGCCCAGATTCTGCTGAAAGCCCTCACCAACCTGCCCCACAC
CGACTTCACTCTGTGTAAATGTATGATCGACCAGGCACATCAAGAAGAGCGGCCCATCCGGCAGATCTTG
TACCTCGGGGACCTGCTGGAGACCTGCCACTTTCAAGCCTTCTGGCAAGCCCTGGATGAGAACATGGACC
TTCTGGAAGGCATAACTGGCTTTGAAGACTCTGTCCGAAAATTTATCTGCCACGTGGTGGGCATCACGTA
CCAGCACATCGACCGCTGGCTGCTGGCCGAGATGCTCGGAGACCTGACTGACAACCAGCTGAAGGTGTGG
ATGAGCAAGTACGGCTGGAGCGCTGACGAGTCAGGGCAGGTCTTCATCTGCAGCCAGGAAGAGAGCATTA
AGCCCAAGAACATCGTGGAGAAGATTGACTTTGACAGTGTGTCCAGCATCATGGCCTCCTCCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201715 representing BC027638
Red=Cloning site Green=Tags(s)

MAMFEQMRANVGKLLKGIDRYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQIL
YLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVW
MSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN BC027638
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC027638.1
RefSeq Size 670 bp
RefSeq ORF 557 bp
Locus ID 73830
Gene Summary Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...