Zfp36 (NM_011756) Mouse Tagged ORF Clone

CAT#: MG204603

  • TrueORF®

Zfp36 (tGFP-tagged) - Mouse zinc finger protein 36 (Zfp36)

ORF Plasmid: DDK tGFP



  "NM_011756" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms Gos24; Nup475; Tis11; TIS11D; TISII; Ttp; Zfp-36
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204603 representing NM_011756
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTCTCTGCCATCTACGAGAGCCTCCAGTCGATGAGCCATGACCTGTCATCCGACCACGGAGGAA
CCGAATCCCTCGGAGGACTTTGGAACATAAACTCGGACTCCATCCCGTCTGGGGTCACCTCTCGCCTGAC
TGGCCGCTCCACTAGCCTGGTGGAGGGCCGAAGCTGTGGCTGGGTACCCCCACCCCCTGGTTTTGCACCT
TTGGCTCCCCGCCCAGGCCCTGAGCTGTCACCCTCACCTACTTCGCCTACTGCAACTCCCACCACCTCCT
CTCGATACAAGACCGAGCTCTGTCGGACCTACTCAGAAAGCGGGCGTTGTCGCTACGGGGCCAAGTGCCA
GTTTGCTCACGGCCTGGGTGAACTTCGCCAAGCCAATCGCCACCCCAAGTACAAAACGGAACTCTGCCAC
AAGTTCTACCTCCAGGGCCGCTGCCCCTATGGCTCTCGATGCCACTTCATCCACAACCCCACCGAGGACC
TAGCTCTCCCTGGCCAGCCCCATGTGCTGCGACAAAGCATCAGCTTCTCCGGCTTGCCCTCAGGCCGCAG
AAGCTCGCCGCCACCTCCAGGCTTTTCTGGCCCTTCCCTGTCCTCTTGTTCCTTTTCGCCTTCCAGCTCC
CCACCGCCCCCTGGGGATCTTCCACTTTCCCCTTCTGCCTTCTCTGCTGCCCCTGGGACCCCTGTGACTC
GAAGAGACCCTAACCAGGCCTGTTGCCCCTCCTGCCGAAGGTCTACTACCCCCAGCACCATCTGGGGGCC
CTTGGGTGGCCTGGCTCGGAGCCCATCTGCCCACTCTCTGGGATCCGATCCTGATGACTACGCCAGCAGC
GGCAGCAGCCTGGGGGGGTCAGACTCACCTGTCTTTGAGGCAGGGGTGTTTGGGCCTCCCCAGACCCCTG
CACCCCCAAGGCGTCTCCCCATCTTCAATCGTATCTCTGTCTCTGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204603 representing NM_011756
Red=Cloning site Green=Tags(s)

MDLSAIYESLQSMSHDLSSDHGGTESLGGLWNINSDSIPSGVTSRLTGRSTSLVEGRSCGWVPPPPGFAP
LAPRPGPELSPSPTSPTATPTTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCH
KFYLQGRCPYGSRCHFIHNPTEDLALPGQPHVLRQSISFSGLPSGRRSSPPPPGFSGPSLSSCSFSPSSS
PPPPGDLPLSPSAFSAAPGTPVTRRDPNQACCPSCRRSTTPSTIWGPLGGLARSPSAHSLGSDPDDYASS
GSSLGGSDSPVFEAGVFGPPQTPAPPRRLPIFNRISVSE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011756
ORF Size 957 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011756.4, NP_035886.1
RefSeq Size 1765 bp
RefSeq ORF 960 bp
Locus ID 22695
UniProt ID P22893
Gene Summary Zinc-finger RNA-binding protein that destabilizes numerous cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:10330172, PubMed:10706852, PubMed:10805719, PubMed:15014438, PubMed:15187092, PubMed:15634918, PubMed:17030620, PubMed:19188452, PubMed:20595389, PubMed:21078877, PubMed:22701344, PubMed:27193233). Acts as an 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:21278420). Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1, and hence promotes ARE-mediated mRNA deadenylation (PubMed:21278420). Functions also by recruiting components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs (PubMed:21278420). Self regulates by destabilizing its own mRNA (PubMed:15187092, PubMed:17288565). Binds to 3' UTR ARE of numerous mRNAs and of its own mRNA (PubMed:11533235, PubMed:15187092, PubMed:16508014, PubMed:17288565, PubMed:17971298, PubMed:20595389, PubMed:21078877, PubMed:21278420, PubMed:22701344, PubMed:27193233). Plays a role in anti-inflammatory responses; suppresses tumor necrosis factor (TNF)-alpha production by stimulating ARE-mediated TNF-alpha mRNA decay and several other inflammatory ARE-containing mRNAs in interferon (IFN)- and/or lipopolysaccharide (LPS)-induced macrophages (PubMed:8630730, PubMed:9703499, PubMed:15014438, PubMed:16514065). Plays also a role in the regulation of dendritic cell maturation at the post-transcriptional level, and hence operates as part of a negative feedback loop to limit the inflammatory response (By similarity). Promotes ARE-mediated mRNA decay of hypoxia-inducible factor HIF1A mRNA during the response of endothelial cells to hypoxia (By similarity). Positively regulates early adipogenesis of preadipocytes by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (PubMed:22701344). Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (By similarity). Plays a role in maintaining skeletal muscle satellite cell quiescence by promoting ARE-mediated mRNA decay of the myogenic determination factor MYOD1 mRNA (PubMed:25815583). Associates also with and regulates the expression of non-ARE-containing target mRNAs at the post-transcriptional level, such as MHC class I mRNAs (By similarity). Participates in association with argonaute RISC catalytic components in the ARE-mediated mRNA decay mechanism; assists microRNA (miRNA) targeting ARE-containing mRNAs (By similarity). May also play a role in the regulation of cytoplasmic mRNA decapping; enhances decapping of ARE-containing RNAs, in vitro (By similarity). Involved in the delivery of target ARE-mRNAs to processing bodies (PBs) (By similarity). In addition to its cytosolic mRNA-decay function, affects nuclear pre-mRNA processing (PubMed:22844456). Negatively regulates nuclear poly(A)-binding protein PABPN1-stimulated polyadenylation activity on ARE-containing pre-mRNA during LPS-stimulated macrophages (PubMed:22844456). Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (PubMed:15967811). Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis (By similarity). Plays a role as a tumor suppressor by inhibiting cell proliferation in breast cancer cells (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...