Six3 (NM_011381) Mouse Tagged ORF Clone

CAT#: MG204911

  • TrueORF®

Six3 (tGFP-tagged) - Mouse sine oculis-related homeobox 3 homolog (Drosophila) (Six3)

ORF Plasmid: DDK tGFP



  "NM_011381" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms E130112M24Rik; Six3a; Six3alpha; Six3b; Six3beta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204911 representing NM_011381
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTATTCCGCTCCCCCCTAGATCTCTATTCCTCCCACTTCTTGTTGCCAAACTTCGCCGATTCTCACC
ACTGCTCCCTACTTCTGGCGAGTAGCGGCGGCGGGAGCGGTGCGAGCGGCGGCGGCGGCGGCGCGGGAGG
AGGCGGCGGCGGGAACCGTGCGGGAGGCGGCGGTGCTGGCGGAGCAGGCGGCGGCAGCGGCGGCGGCGGC
TCCAGGGCCCCCCCGGAAGAGTTGTCCATGTTCCAGTTGCCCACCCTCAACTTCTCGCCGGAGCAGGTGG
CCAGCGTCTGCGAGACGCTGGAGGAGACGGGCGACATCGAGCGGCTGGGCCGCTTCCTCTGGTCGCTGCC
CGTGGCCCCCGGGGCGTGCGAGGCCATCAACAAACACGAGTCGATCCTGCGCGCGCGCGCTGTCGTCGCC
TTCCACACCGGCAACTTCCGCGACCTGTACCACATCCTGGAGAACCACAAGTTCACTAAGGAGTCTCACG
GCAAGCTGCAAGCCATGTGGCTCGAGGCGCACTACCAGGAGGCCGAGAAGCTGCGCGGCCGCCCGCTCGG
CCCGGTGGACAAGTACCGCGTGCGCAAGAAGTTCCCTCTGCCGCGCACCATCTGGGATGGCGAGCAGAAG
ACCCATTGCTTCAAGGAGCGGACTCGGAGCCTGCTGCGGGAGTGGTACCTGCAGGATCCCTACCCCAACC
CCAGCAAGAAACGCGAACTGGCGCAGGCCACCGGCCTCACCCCCACACAAGTAGGCAACTGGTTTAAGAA
CCGGCGACAGCGCGACCGCGCAGCGGCGGCCAAGAACAGGCTCCAGCATCAGGCCATCGGGCCGAGCGGG
ATGCGCTCGCTGGCCGAGCCCGGCTGCCCCACGCACGGCTCAGCAGAGTCACCGTCCACGGCGGCCAGCC
CGACCACCAGTGTGTCCAGCCTGACGGAGCGCGCGGACACCGGCACTTCGATCCTCTCGGTAACCTCCAG
CGACTCGGAATGTGATGTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204911 representing NM_011381
Red=Cloning site Green=Tags(s)

MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGASGGGGGAGGGGGGNRAGGGGAGGAGGGSGGGG
SRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVA
FHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQK
THCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSG
MRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011381
ORF Size 999 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011381.4, NP_035511.2
RefSeq Size 3680 bp
RefSeq ORF 1002 bp
Locus ID 20473
UniProt ID Q62233
Gene Summary Transcriptional regulator which can act as both a transcriptional repressor and activator by binding a ATTA homeodomain core recognition sequence on these target genes. During forebrain development represses WNT1 expression allowing zona limitans intrathalamica formation and thereby ensuring proper anterio-posterior patterning of the diencephalon and formation of the rostral diencephalon (PubMed:18094027). Acts as a direct upstream activator of SHH expression in the rostral diencephalon ventral midline and that in turn SHH maintains its expression (PubMed:18775421). In addition, Six3 activity is required for the formation of the telencephalon. During postnatal stages of brain development is necessary for ependymal cell maturation by promoting the maturation of radial glia into ependymal cells through regulation of neuroblast proliferation and migration (PubMed:22071110). Acts on the proliferation and differentiation of neural progenitor cells through activating transcription of CCND1 AND CCND2 (PubMed:17576749). During early lens formation plays a role in lens induction and specification by activating directly PAX6 in the presumptive lens ectoderm (PubMed:17066077). In turn PAX6 activates SIX3 resulting in activation of PDGFRA and CCND1 promoting cell proliferation (PubMed:12072567). Also is required for the neuroretina development by directly suppressing WNT8B expression in the anterior neural plate territory (PubMed:20890044). Its action during retina development and lens morphogenesis is TLE5 and TLE4-dependent manner. Furthermore, during eye development regulates several genes expression. Before and during early lens development represses the CRYGF promoter by binding a SIX repressor element (PubMed:11139622). Directly activates RHO transcription, or cooperates with CRX or NRL (PubMed:17666527). Six3 functions also in the formation of the proximodistal axis of the optic cup (PubMed:12163408), and promotes the formation of optic vesicles-like structures (PubMed:11458394). During pituitary development, acts in parallel or alternatively with HESX1 to control cell proliferation through Wnt/beta-catenin pathway (PubMed:18694563). Plays a role in eye development by suppressing WNT1 expression and in dorsal-ventral patterning by repressing BMP signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...