RAB10 (NM_016131) Human Tagged ORF Clone
CAT#: RC201464
RAB10 (Myc-DDK-tagged)-Human RAB10, member RAS oncogene family (RAB10)
ORF Plasmid: tGFP
"NM_016131" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 5 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201464 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGAAGAAGACGTACGACCTGCTTTTCAAGCTGCTCCTGATCGGGGATTCCGGAGTGGGGAAGACCT GCGTCCTTTTTCGTTTTTCGGATGATGCCTTCAATACTACCTTTATTTCCACCATAGGAATAGACTTCAA GATCAAAACAGTTGAATTACAAGGAAAGAAGATCAAGCTACAGATATGGGATACAGCAGGCCAGGAGCGA TTTCACACCATCACAACCTCCTACTACAGAGGCGCAATGGGTATCATGCTAGTATATGACATCACCAATG GTAAAAGTTTTGAAAACATCAGCAAATGGCTTAGAAACATAGATGAGCATGCCAATGAAGATGTGGAAAG AATGTTACTAGGAAACAAGTGTGATATGGACGACAAAAGAGTTGTACCTAAAGGAAAAGGAGAACAGATT GCAAGGGAGCATGGTATTAGGTTTTTTGAGACTAGTGCAAAAGCAAATATAAACATCGAAAAGGCGTTCC TCACGTTAGCTGAAGATATCCTTCGAAAGACCCCTGTAAAAGAGCCCAACAGTGAAAATGTAGATATCAG CAGTGGAGGAGGCGTGACAGGCTGGAAGAGCAAATGCTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201464 protein sequence
Red=Cloning site Green=Tags(s) MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_016131 |
ORF Size | 600 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_016131.5 |
RefSeq Size | 3785 bp |
RefSeq ORF | 603 bp |
Locus ID | 10890 |
UniProt ID | P61026 |
Domains | ras, RAN, RAS, RHO, RAB |
Protein Families | Druggable Genome |
MW | 22.5 kDa |
Gene Summary | RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 [PubMed 9918381]).[supplied by OMIM, Mar 2009] |
Citations (5)
The use of this cDNA Clones has been cited in the following citations: |
---|
DJ-1 is an essential downstream mediator in PINK1/parkin-dependent mitophagy
,null,
Brain
,PubMed ID 36039535
[RAB10]
|
RAB8, RAB10 and RILPL1 contribute to both LRRK2 kinase-mediated centrosomal cohesion and ciliogenesis deficits
,Ordóñez, AJL;Fernández, B;Fdez, E;Romo-Lozano, M;Madero-Pérez, J;Lobbestael, E;Baekelandt, V;Aiastui, A;Munaín, AL;Melrose, HL;Civiero, L;Hilfiker, S;,
Hum. Mol. Genet.
,PubMed ID 31428781
[RAB10]
|
LRRK2 mutations impair depolarization-induced mitophagy through inhibition of mitochondrial accumulation of RAB10
,Wauters, F;Cornelissen, T;Imberechts, D;Martin, S;Koentjoro, B;Sue, C;Vangheluwe, P;Vandenberghe, W;,
Autophagy
,PubMed ID 30945962
[RAB10]
|
Kinase activity of mutant LRRK2 manifests differently in hetero-dimeric vs homo-dimeric complexes
,Leandrou, E;Markidi, E;Memou, A;Melachroinou, K;Greggio, E;Rideout, HJ;,
Biochem. J.
,PubMed ID 30670570
[RAB10]
|
Linkage, whole genome sequence, and biological data implicate variants in RAB10 in Alzheimer's disease resilience
,Ridge, PG;Karch, CM;Hsu, S;Arano, I;Teerlink, CC;Ebbert, MTW;Gonzalez Murcia, JD;Farnham, JM;Damato, AR;Allen, M;Wang, X;Harari, O;Fernandez, VM;Guerreiro, R;Bras, J;Hardy, J;Munger, R;Norton, M;Sassi, C;Singleton, A;Younkin, SG;Dickson, DW;Golde, TE;Price, ND;Ertekin-Taner, N;Cruchaga, C;Goate, AM;Corcoran, C;Tschanz, J;Cannon-Albright, LA;Kauwe, JSK;, ;,
Genome Med
,PubMed ID 29183403
[RAB10]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201464L1 | Lenti ORF clone of Human RAB10, member RAS oncogene family (RAB10), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC201464L2 | Lenti ORF clone of Human RAB10, member RAS oncogene family (RAB10), mGFP tagged |
CNY 5,890.00 |
|
RC201464L3 | Lenti ORF clone of Human RAB10, member RAS oncogene family (RAB10), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC201464L4 | Lenti ORF clone of Human RAB10, member RAS oncogene family (RAB10), mGFP tagged |
CNY 5,890.00 |
|
RG201464 | RAB10 (tGFP-tagged) - Human RAB10, member RAS oncogene family (RAB10) |
CNY 5,200.00 |
|
SC114472 | RAB10 (untagged)-Human RAB10, member RAS oncogene family (RAB10) |
CNY 3,600.00 |
|
SC322239 | RAB10 (untagged)-Human RAB10, member RAS oncogene family (RAB10) |
CNY 3,600.00 |