liver FABP (FABP1) (NM_001443) Human Tagged ORF Clone
CAT#: RC207592
FABP1 (Myc-DDK-tagged)-Human fatty acid binding protein 1, liver (FABP1)
ORF Plasmid: tGFP
"NM_001443" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | FABPL; L-FABP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207592 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTTTCTCCGGCAAGTACCAACTGCAGAGCCAGGAAAACTTTGAAGCCTTCATGAAGGCAATCGGTC TGCCGGAAGAGCTCATCCAGAAGGGGAAGGATATCAAGGGGGTGTCGGAAATCGTGCAGAATGGGAAGCA CTTCAAGTTCACCATCACCGCTGGGTCCAAAGTGATCCAAAACGAATTCACGGTGGGGGAGGAATGTGAG CTGGAGACAATGACAGGGGAGAAAGTCAAGACAGTGGTTCAGTTGGAAGGTGACAATAAACTGGTGACAA CTTTCAAAAACATCAAGTCTGTGACCGAACTCAACGGCGACATAATCACCAATACCATGACATTGGGTGA CATTGTCTTCAAGAGAATCAGCAAGAGAATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207592 protein sequence
Red=Cloning site Green=Tags(s) MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001443 |
ORF Size | 381 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001443.3 |
RefSeq Size | 598 bp |
RefSeq ORF | 384 bp |
Locus ID | 2168 |
UniProt ID | P07148 |
Domains | lipocalin |
Protein Pathways | PPAR signaling pathway |
MW | 14.2 kDa |
Gene Summary | This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Liver fatty acid binding protein protects renal function through down-regulation of oxidative stress in IgA nephropathy
,Shen, P;Li, W;Jiang, J;He, L;,
Int J Clin Exp Pathol
[liver FABP]
|
Human FABP1 T94A variant enhances cholesterol uptake
,Huang, H;McIntosh, AL;Landrock, KK;Landrock, D;Storey, SM;Martin, GG;Gupta, S;Atshaves, BP;Kier, AB;Schroeder, F;,
Biochim. Biophys. Acta
,PubMed ID 25732850
[liver FABP]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207592L1 | Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC207592L2 | Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), mGFP tagged |
CNY 5,890.00 |
|
RC207592L3 | Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC207592L4 | Lenti ORF clone of Human fatty acid binding protein 1, liver (FABP1), mGFP tagged |
CNY 3,600.00 |
|
RG207592 | FABP1 (tGFP-tagged) - Human fatty acid binding protein 1, liver (FABP1) |
CNY 2,800.00 |
|
SC119222 | FABP1 (untagged)-Human fatty acid binding protein 1, liver (FABP1) |
CNY 1,200.00 |
其它liver FABP产品