PSMB9 (NM_002800) Human Tagged ORF Clone

CAT#: RC209001

PSMB9 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) (PSMB9)

ORF Plasmid: DDK tGFP



  "NM_002800" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2400.00

CNY 3705.00


货期*
现货

规格
    • 10 ug

Product images

推荐一起购买 (6)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
    • 5 ml

CNY 6840.00


PSMB9 (Proteasome 20S LMP2) mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
    • 100 ul

CNY 1999.00
CNY 2700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms beta1i; LMP2; PRAAS3; PSMB6i; RING12
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209001 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGGCGGGAGCACCAACCGGGGACTTACCCCGGGCGGGAGAAGTCCACACCGGGACCACCATCA
TGGCAGTGGAGTTTGACGGGGGCGTTGTGATGGGTTCTGATTCCCGAGTGTCTGCAGGCGAGGCGGTGGT
GAACCGAGTGTTTGACAAGCTGTCCCCGCTGCACGAGCGCATCTACTGTGCACTCTCTGGTTCAGCTGCT
GATGCCCAAGCCGTGGCCGACATGGCCGCCTACCAGCTGGAGCTCCATGGGATAGAACTGGAGGAACCTC
CACTTGTTTTGGCTGCTGCAAATGTGGTGAGAAATATCAGCTATAAATATCGAGAGGACTTGTCTGCACA
TCTCATGGTAGCTGGCTGGGACCAACGTGAAGGAGGTCAGGTATATGGAACCCTGGGAGGAATGCTGACT
CGACAGCCTTTTGCCATTGGTGGCTCCGGCAGCACCTTTATCTATGGTTATGTGGATGCAGCATATAAGC
CAGGCATGTCTCCCGAGGAGTGCAGGCGCTTCACCACAGACGCTATTGCTCTGGCCATGAGCCGGGATGG
CTCAAGCGGGGGTGTCATCTACCTGGTCACTATTACAGCTGCCGGTGTGGACCATCGAGTCATCTTGGGC
AATGAACTGCCAAAATTCTATGATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209001 protein sequence
Red=Cloning site Green=Tags(s)

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAA
DAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLT
RQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILG
NELPKFYDE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NM_002800
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_002800.5
RefSeq Size 1048 bp
RefSeq ORF 660 bp
Locus ID 5698
UniProt ID P28065
Domains proteasome
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
MW 23.3 kDa
Gene Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. [provided by RefSeq, Mar 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...