WWOX (NM_130844) Human Tagged ORF Clone
CAT#: RC213172
- TrueORF®
WWOX (Myc-DDK-tagged)-Human WW domain containing oxidoreductase (WWOX), transcript variant 3
ORF Plasmid: tGFP
"NM_130844" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | D16S432E; FOR; FRA16D; HHCMA56; PRO0128; SCAR12; SDR41C1; WOX1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213172 representing NM_130844
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGCGCTGCGCTACGCGGGGCTGGACGACACGGACAGTGAGGACGAGCTGCCTCCGGGCTGGGAGG AGAGAACCACCAAGGACGGCTGGGTTTACTACGCCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213172 representing NM_130844
Red=Cloning site Green=Tags(s) MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYAK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_130844 |
ORF Size | 108 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_130844.2, NP_570859.1 |
RefSeq Size | 793 bp |
RefSeq ORF | 111 bp |
Locus ID | 51741 |
Protein Families | Druggable Genome |
MW | 4.6 kDa |
Gene Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induce apoptosis, while defects in this gene are associated with multiple types of cancer. Disruption of this gene is also associated with autosomal recessive spinocerebellar ataxia 12. Disruption of a similar gene in mouse results in impaired steroidogenesis, additionally suggesting a metabolic function for the protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213172L3 | Lenti ORF clone of Human WW domain containing oxidoreductase (WWOX), transcript variant 3, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC213172L4 | Lenti ORF clone of Human WW domain containing oxidoreductase (WWOX), transcript variant 3, mGFP tagged |
CNY 5,890.00 |
|
RG213172 | WWOX (tGFP-tagged) - Human WW domain containing oxidoreductase (WWOX), transcript variant 3 |
CNY 4,370.00 |
|
SC305918 | WWOX (untagged)-Human WW domain containing oxidoreductase (WWOX), transcript variant 3 |
CNY 3,990.00 |