Caveolin 2 (CAV2) (NM_198212) Human Tagged ORF Clone
CAT#: RC217364
CAV2 (Myc-DDK-tagged)-Human caveolin 2 (CAV2), transcript variant 2
ORF Plasmid: tGFP
"NM_198212" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CAV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217364 representing NM_198212
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGCTGGAGACGGAGAAGGCGGACGTACAGCTCTTCATGGACGACGACTCCTACAGCCACCACAGCG GCCTCGAGTACGCCGACCCCGAGAAGTTCGCGGACTCGGACCAGGACCGGGATCCCCACCGGCTCAACTC GCATCTCAAGGATTTTAATGCCTTTTGTAAAGACCTGCCTAATGGTTCTGCCTTCAGTGCAGACAATATG GAAGAGTGTGACAGATGTTATCATTGCTCCATTGTGTACGAGCGTAGGACGATGCTTCTCTTCTGTCAGC CTGCAACTGAGCCAGGATTGAATACTTGGACCCCAGGTCTGGAGATTGGGATACTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217364 representing NM_198212
Red=Cloning site Green=Tags(s) MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKDFNAFCKDLPNGSAFSADNM EECDRCYHCSIVYERRTMLLFCQPATEPGLNTWTPGLEIGIL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_198212 |
ORF Size | 336 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_198212.3 |
RefSeq Size | 3144 bp |
RefSeq ORF | 339 bp |
Locus ID | 858 |
UniProt ID | P51636 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Focal adhesion |
MW | 12.6 kDa |
Gene Summary | The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). [provided by RefSeq, May 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217364L1 | Lenti ORF clone of Human caveolin 2 (CAV2), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC217364L2 | Lenti ORF clone of Human caveolin 2 (CAV2), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC217364L3 | Lenti ORF clone of Human caveolin 2 (CAV2), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC217364L4 | Lenti ORF clone of Human caveolin 2 (CAV2), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG217364 | CAV2 (tGFP-tagged) - Human caveolin 2 (CAV2), transcript variant 2 |
CNY 2,800.00 |
|
SC307649 | CAV2 (untagged)-Human caveolin 2 (CAV2), transcript variant 2 |
CNY 3,990.00 |
其它Caveolin 2产品