UBE2V1 (NM_022442) Human Tagged ORF Clone
CAT#: RC222103
- TrueORF®
UBE2V1 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 3
ORF Plasmid: tGFP
"NM_022442" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CIR1; CROC-1; CROC1; UBE2V; UEV-1; UEV1; UEV1A |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC222103 representing NM_022442
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGGAAGACTTGAACCTAGAAAATTTCACTGCAAAGACAATTTATGAAAACCGAATATACAGCCTTA AAATAGAATGTGGACCTAAATACCCAGAAGCACCCCCCTTTGTAAGATTTGTAACAAAAATTAATATGAA TGGAGTAAATAGTTCTAATGGAGTGGTGGACCCAAGAGCCATATCAGTGCTAGCAAAATGGCAGAATTCA TATAGCATCAAAGTTGTCCTGCAAGAGCTTCGGCGCCTAATGATGTCTAAAGAAAATATGAAACTCCCTC AGCCGCCCGAAGGACAGTGTTACAGCAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC222103 representing NM_022442
Red=Cloning site Green=Tags(s) MKEDLNLENFTAKTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNS YSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_022442 |
ORF Size | 309 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_022442.6 |
RefSeq Size | 2184 bp |
RefSeq ORF | 312 bp |
Locus ID | 7335 |
UniProt ID | Q13404 |
Domains | UBCc |
Protein Families | Druggable Genome, Transcription Factors |
MW | 11.8 kDa |
Gene Summary | Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Apr 2012] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC222103L3 | Lenti-ORF clone of UBE2V1 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 3 |
CNY 5,890.00 |
|
RC222103L4 | Lenti-ORF clone of UBE2V1 (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 3 |
CNY 5,890.00 |
|
RG222103 | UBE2V1 (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 3 |
CNY 4,370.00 |
|
SC311658 | UBE2V1 (untagged)-Human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 3 |
CNY 3,990.00 |