SCN4B (NM_174934) Human Tagged ORF Clone
CAT#: RC223951
SCN4B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1
ORF Plasmid: tGFP
"NM_174934" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ATFB17; LQT10; Navbeta4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223951 representing NM_174934
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCGGGGCTGGGGACGGAGGCAAAGCCCCGGCGAGATGGCTGGGCACTGGGCTTTTGGGCCTCTTCC TGCTCCCCGTAACCCTGTCGCTGGAGGTGTCTGTGGGAAAGGCCACCGACATCTACGCTGTCAATGGCAC GGAGATCCTGCTGCCCTGCACCTTCTCCAGCTGCTTTGGCTTCGAGGACCTCCACTTCCGGTGGACCTAC AACAGCAGTGACGCATTCAAGATTCTCATAGAGGGGACTGTGAAGAATGAGAAGTCTGACCCCAAGGTGA CGTTGAAAGACGATGACCGCATCACTCTGGTAGGCTCTACTAAGGAGAAGATGAACAACATTTCCATTGT GCTGAGGGACCTGGAGTTCAGCGACACGGGCAAATACACCTGCCATGTGAAGAACCCCAAGGAGAATAAT CTCCAGCACCACGCCACCATCTTCCTCCAAGTCGTTGATAGACTGGAAGAAGTGGACAACACAGTGACAC TCATCATCCTGGCTGTCGTGGGCGGGGTCATCGGGCTCCTCATCCTCATCCTGCTGATCAAGAAACTCAT CATCTTCATCCTGAAGAAGACTCGGGAGAAGAAGAAGGAGTGTCTCGTGAGCTCCTCGGGGAATGACAAC ACGGAGAACGGCTTGCCTGGCTCCAAGGCAGAGGAGAAACCACCTTCAAAAGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223951 representing NM_174934
Red=Cloning site Green=Tags(s) MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN TENGLPGSKAEEKPPSKV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_174934 |
ORF Size | 684 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_174934.4 |
RefSeq Size | 4489 bp |
RefSeq ORF | 687 bp |
Locus ID | 6330 |
UniProt ID | Q8IWT1 |
Protein Families | Ion Channels: Sodium, Transmembrane |
MW | 22 kDa |
Gene Summary | The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.[provided by RefSeq, Mar 2009] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Identification of rare variants in cardiac sodium channel β4-subunit gene SCN4B associated with ventricular tachycardia
,Yang, Q;Xiong, H;Xu, C;Huang, Y;Tu, X;Wu, G;Fu, F;Wang, Z;Wang, L;Zhao, Y;Li, S;Huang, Y;Wang, C;Wang, D;Yao, Y;Wang, F;Wang, Y;Xue, Y;Wang, P;Chen, Q;Pu, J;Wang, QK;,
Mol. Genet. Genomics
,PubMed ID 31020414
[SCN4B]
|
Intrinsic CD4(+) T cell sensitivity and response to a pathogen are set and sustained by avidity for thymic and peripheral complexes of self peptide and MHC
,Persaud, SP;Parker, CR;Lo, WL;Weber, KS;Allen, PM;,
Nat. Immunol., Feb 2014.
,PubMed ID 24487322
[SCN4B]
|
A voltage-gated sodium channel is essential for the positive selection of CD4+ T cells
,null,
Nature immunology
,PubMed ID 22842345
[SCN4B]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223951L1 | Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC223951L2 | Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC223951L3 | Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC223951L4 | Lenti ORF clone of Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
RG223951 | SCN4B (tGFP-tagged) - Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1 |
CNY 5,200.00 |
|
SC123982 | SCN4B (untagged)-Human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1 |
CNY 3,600.00 |