Cytochrome P450 3A5 (CYP3A5) (NM_001190484) Human Tagged ORF Clone
CAT#: RC230978
- TrueORF®
CYP3A5 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2
ORF Plasmid: tGFP
"NM_001190484" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CP35; CYPIIIA5; P450PCN3; PCN3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC230978 representing NM_001190484
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACCTCATCCCAAATTTGGCGGTGGAAACCTGGCTTCTCCTGGCTGTCAGCCTGGTGCTCCTCTATC TATATGGGACCCGTACACATGGACTTTTTAAGAGACTGGGAATTCCAGGGCCCACACCTCTGCCTTTGTT GGGAAATGTTTTGTCCTATCGTCAGGGTCTCTGGAAATTTGACACAGAGTGCTATAAAAAGTATGGAAAA ATGTGGGGAACGTATGAAGGTCAACTCCCTGTGCTGGCCATCACAGATCCCGACGTGATCAGAACAGTGC TAGTGAAAGAATGTTATTCTGTCTTCACAAATCGAAGGATTTGTGCAACGACCAGCACCATCAAGATGCA GACCCATTCCGTCACCATGTGGCTCCCTCCTGCTGTCCTACAGTCACAACATGGAGTTTGTCTTTTTCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC230978 representing NM_001190484
Red=Cloning site Green=Tags(s) MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGK MWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001190484 |
ORF Size | 420 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001190484.3 |
RefSeq ORF | 423 bp |
Locus ID | 1577 |
UniProt ID | P20815 |
Protein Families | Druggable Genome, P450, Transmembrane |
Protein Pathways | Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Linoleic acid metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism |
MW | 16.3 kDa |
Gene Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protein metabolizes drugs as well as the steroid hormones testosterone and progesterone. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Two pseudogenes of this gene have been identified within this cluster on chromosome 7. Expression of this gene is widely variable among populations, and a single nucleotide polymorphism that affects transcript splicing has been associated with susceptibility to hypertensions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC230978L3 | Lenti-ORF clone of CYP3A5 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2 |
CNY 5,890.00 |
|
RC230978L4 | Lenti-ORF clone of CYP3A5 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2 |
CNY 5,890.00 |
|
RG230978 | CYP3A5 (tGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2 |
CNY 4,370.00 |
其它Cytochrome P450 3A5产品