MEMO1 (NM_001301852) Human Tagged ORF Clone

CAT#: RC236525

  • TrueORF®

MEMO1 (myc-DDK-tagged) - Human mediator of cell motility 1 (MEMO1), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001301852" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal Anti-NCDN Antibody
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms C2orf4; CGI-27; MEMO; NS5ATP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236525 representing NM_001301852
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGATATACGTACTGTGGGTCTTGTGCTGCCCATGCTTATAAACAAGTGGATCCGTCTATTACCCG
GAGAATTTTCATCCTTGGGCCTTCTCATCATGTGCCCCTCTCTCGATGTGCACTTTCCAGTGTGGATATA
TATAGGACACCTCTGTATGACCTTCGTATTGACCAAAAGATTTACGGAGAACTGTGGAAGACAGGAATGT
TTGAACGCATGTCTCTGCAGACAGATGAAGATGAACACAGTATTGAAATGCATTTGCCTTATACAGCTAA
AGCCATGGAAAGGTCAAAGGTTCCGTTACAGTTACTATGATGAATCCCAGGGGGAGATTTATAGATCCAT
TGAACATCTAGATAAAATGGGTATGAGTATTATAGAACAATTAGACCCTGTATCTTTTAGCAATTACTTG
AAGAAATACCATAATACTATATGTGGAAGACATCCCATTGGGGTGTTATTAAATGCTATCACAGAGCTCC
AGAAGAATGGAATGAATATGAGTTTTTCGTTTTTGAATTATGCCCAGTCGAGCCAGTGTAGAAACTGGCA
AGACAGTTCAGTGAGTTATGCAGCTGGAGCACTCACGGTCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236525 representing NM_001301852
Red=Cloning site Green=Tags(s)

MQDIRTVGLVLPMLINKWIRLLPGEFSSLGLLIMCPSLDVHFPVWIYIGHLCMTFVLTKRFTENCGRQEC
LNACLCRQMKMNTVLKCICLIQLKPWKGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYL
KKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301852
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001301852.3
RefSeq Size 1368 bp
RefSeq ORF 606 bp
Locus ID 51072
UniProt ID Q9Y316
MW 23.7 kDa
Gene Summary May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...