Havcr2 (NM_001100762) Rat Tagged ORF Clone

CAT#: RR206032

  • TrueORF®

Havcr2 (Myc-DDK-tagged ORF) - Rat hepatitis A virus cellular receptor 2 (Havcr2), (10 ug)



  "NM_001100762" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Synonyms tim3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR206032 representing NM_001100762
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTCATGGCTTCCCTTCAGCTGTGCCCTGCTGCTGCTGCAACCACTACCTGCAAGGTCCTTGGAAA
ATGCTTACACAGCTGAGGTCGGGAAGAATGCCTATCTGCCCTGCAGCTACACTGTACCTGCCCCTGGGAC
GCTCGTGCCTATCTGCTGGGGCAAGGGATCCTGTCCTTTGTTACAGTGTGCCAGTGTGGTGCTCAGAACG
GATGAAACGAATGTGACATATCGGAAATCCAGAAGATACCAGCTAAAGGGGAATTTCTACAAAGGAGACA
TGTCGCTGACCATAAAGAATGTGACTCTAGCTGACTCTGGGACCTACTGCTGCAGGATACAATTCCCTGG
CCCAATGAATGATGAAAAATTAGAGCTGAAATTAAGCATCACTGAACCAGCCAAAGTCATCCCAGCTGGG
ACTGCTCATGGGGATTCTACAACAGCTTCTCCCAGAACCCTAACCACTGAGGGAAGTGGCTCAGAGACAC
AGACCCTGGTGACCCTCCATGATAACAATGGAACAAAAATTTCCACATGGGCCGATGAAATTAAGGACTC
TGGAGAAACTATCAGAACTGCTGTCCACATTGGAGTAGGCGTCTCTGCTGGGCTGGCCCTGGCACTTATT
CTTGGTGTTTTAATCCTTAAATGGTATTCCTCTAAGAAAAAGAAGTTGCAGGATTTGAGTCTTATTACAC
TGGCCAACTCCCCACCAGGAGGGTTGGTGAATGCAGGAGCAGGCAGGATTCGGTCTGAGGAAAACATCTA
CACTATAGAGGAGAACATATATGAAATGGAGAATTCAAATGAGTACTACTGCTATGTCAGCAGCCAGCAG
CCATCCCCATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR206032 representing NM_001100762
Red=Cloning site Green=Tags(s)

MFSWLPFSCALLLLQPLPARSLENAYTAEVGKNAYLPCSYTVPAPGTLVPICWGKGSCPLLQCASVVLRT
DETNVTYRKSRRYQLKGNFYKGDMSLTIKNVTLADSGTYCCRIQFPGPMNDEKLELKLSITEPAKVIPAG
TAHGDSTTASPRTLTTEGSGSETQTLVTLHDNNGTKISTWADEIKDSGETIRTAVHIGVGVSAGLALALI
LGVLILKWYSSKKKKLQDLSLITLANSPPGGLVNAGAGRIRSEENIYTIEENIYEMENSNEYYCYVSSQQ
PSPS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001100762
ORF Size 846 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001100762.1, NP_001094232.1
RefSeq Size 2763 bp
RefSeq ORF 849 bp
Locus ID 363578
UniProt ID P0C0K5
MW 30.6 kDa
Gene Summary Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand. Regulates macrophage activation. Inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. In CD8+ cells attenuates TCR-induced signaling, specifically by blocking NF-kappaB and NFAT promoter activities resulting in the loss of IL-2 secretion. The function may implicate its association with LCK proposed to impair phosphorylation of TCR subunits. In contrast, shown to activate TCR-induced signaling in T-cells probably implicating ZAP70, LCP2, LCK and FYN. Expressed on Treg cells can inhibit Th17 cell responses. Receptor for LGALS9. Binding to LGALS9 is believed to result in suppression of T-cell responses; the resulting apoptosis of antigen-specific cells may implicate HAVCR2 phosphorylation and disruption of its association with BAG6. Binding to LGALS9 is proposed to be involved in innate immune response to intracellular pathogens. Expressed on Th1 cells interacts with LGALS9 expressed on Mycobacterium tuberculosis-infected macrophages to stimulate antibactericidal activity including IL-1 beta secretion and to restrict intracellular bacterial growth. However, the function as receptor for LGALS9 has been challenged (By similarity). Also reported to enhance CD8+ T cell responses to an acute infection such as by Listeria monocytogenes. Receptor for phosphatidylserine (PtSer); PtSer-binding is calcium-dependent. May recognize PtSer on apoptotic cells leading to their phagocytosis. Mediates the engulfment of apoptotic cells by dendritic cells. Expressed on T-cells, promotes conjugation but not engulfment of apoptotic cells. Expressed on dendritic cells (DCs) positively regulates innate immune response and in synergy with Toll-like receptors promotes secretion of TNF-alpha. In tumor-imfiltrating DCs suppresses nucleic acid-mediated innate immune repsonse by interaction with HMGB1 and interfering with nucleic acid-sensing and trafficking of nucleid acids to endosomes. Can enhance mast cell production of Th2 cytokines Il-4, IL-6 and IL-13. Expressed on natural killer (NK) cells acts as a coreceptor to enhance IFN-gamma production in response to LGALS9. In contrast, shown to suppress NK cell-mediated cytotoxicity. Negatively regulates NK cell function in LPS-induced endotoxic shock.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...