ZNF174 (NM_001032292) Human Mass Spec Standard
CAT#: PH300400
ZNF174 MS Standard C13 and N15-labeled recombinant protein (NP_001027463)
View other "ZNF174" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ZNF174 MS Standard C13 and N15-labeled recombinant protein (NP_001027463) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200400 |
Predicted MW | 26.9 kDa |
Protein Sequence |
>RC200400 protein sequence
Red=Cloning site Green=Tags(s) MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQL CRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQ GQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEL LIEKTDPNMATDELPCKLWLSFIA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001027463 |
RefSeq Size | 1593 |
RefSeq ORF | 702 |
Synonyms | ZSCAN8 |
Locus ID | 7727 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2016] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418676 | ZNF174 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422302 | ZNF174 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418676 | Transient overexpression lysate of zinc finger protein 174 (ZNF174), transcript variant 1 |
CNY 3080.00 |
|
LY422302 | Transient overexpression lysate of zinc finger protein 174 (ZNF174), transcript variant 2 |
CNY 3080.00 |
|
TP300400 | Recombinant protein of human zinc finger protein 174 (ZNF174), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761180 | Purified recombinant protein of Human zinc finger protein 174 (ZNF174), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |