XTP3TPA (DCTPP1) (NM_024096) Human Mass Spec Standard
CAT#: PH301727
DCTPP1 MS Standard C13 and N15-labeled recombinant protein (NP_077001)
View other "XTP3TPA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DCTPP1 MS Standard C13 and N15-labeled recombinant protein (NP_077001) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201727 |
Predicted MW | 18.7 kDa |
Protein Sequence |
>RC201727 protein sequence
Red=Cloning site Green=Tags(s) MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK YTELPHGAISEDQAVGPADIPCDSTGQTST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_077001 |
RefSeq Size | 1143 |
RefSeq ORF | 510 |
Synonyms | CDA03; RS21C6; XTP3TPA |
Locus ID | 79077 |
Cytogenetics | 16p11.2 |
Summary | The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411367 | DCTPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411367 | Transient overexpression lysate of dCTP pyrophosphatase 1 (DCTPP1) |
CNY 3080.00 |
|
TP301727 | Recombinant protein of human dCTP pyrophosphatase 1 (DCTPP1), 20 µg |
CNY 2900.00 |
其它XTP3TPA产品