TTC11 (FIS1) (NM_016068) Human Mass Spec Standard
CAT#: PH302560
FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152)
View other "TTC11" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202560 |
| Predicted MW | 16.9 kDa |
| Protein Sequence |
>RC202560 protein sequence
Red=Cloning site Green=Tags(s) MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA GLIGLAVSKSKS TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057152 |
| RefSeq Size | 785 |
| RefSeq ORF | 456 |
| Synonyms | CGI-135; TTC11 |
| Locus ID | 51024 |
| Cytogenetics | 7q22.1 |
| Summary | The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402496 | FIS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402496 | Transient overexpression lysate of fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP302560 | Recombinant protein of human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
|
| TP720888 | Purified recombinant protein of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein |
CNY 1800.00 |
