S100 calcium binding protein A14 (S100A14) (NM_020672) Human Mass Spec Standard
CAT#: PH302590
S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723)
View other "S100 calcium binding protein A14" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202590 |
| Predicted MW | 11.7 kDa |
| Protein Sequence |
>RC202590 protein sequence
Red=Cloning site Green=Tags(s) MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065723 |
| RefSeq Size | 1075 |
| RefSeq ORF | 312 |
| Synonyms | BCMP84; S100A15 |
| Locus ID | 57402 |
| Cytogenetics | 1q21.3 |
| Summary | This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402803 | S100A14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402803 | Transient overexpression lysate of S100 calcium binding protein A14 (S100A14) |
CNY 3080.00 |
|
| TP302590 | Recombinant protein of human S100 calcium binding protein A14 (S100A14), 20 µg |
CNY 2900.00 |
其它S100 calcium binding protein A14产品


