FKBP14 (NM_017946) Human Mass Spec Standard
CAT#: PH302674
FKBP14 MS Standard C13 and N15-labeled recombinant protein (NP_060416)
View other "FKBP14" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FKBP14 MS Standard C13 and N15-labeled recombinant protein (NP_060416) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202674 |
| Predicted MW | 24.2 kDa |
| Protein Sequence |
>RC202674 protein sequence
Red=Cloning site Green=Tags(s) MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060416 |
| RefSeq Size | 5086 |
| RefSeq ORF | 633 |
| Synonyms | EDSKMH; EDSKSCL2; FKBP22; IPBP12 |
| Locus ID | 55033 |
| Cytogenetics | 7p14.3 |
| Summary | The protein encoded by this gene is a member of the FK506-binding protein family of peptidyl-prolyl cis-trans isomerases. The encoded protein is found in the lumen of the endoplasmic reticulum, where it is thought to accelerate protein folding. Defects in this gene are a cause of a type of Ehlers-Danlos syndrome (EDS). Both a protein-coding variant and noncoding variants are transcribed from this gene. [provided by RefSeq, Mar 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413430 | FKBP14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413430 | Transient overexpression lysate of FK506 binding protein 14, 22 kDa (FKBP14) |
CNY 3080.00 |
|
| TP302674 | Recombinant protein of human FK506 binding protein 14, 22 kDa (FKBP14), 20 µg |
CNY 2900.00 |

