EFCAB2 (NM_032328) Human Mass Spec Standard
CAT＃: PH302779
EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_115704)
View other "EFCAB2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
Specifications
| Product Data | |
| Description | EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_115704) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202779 |
| Predicted MW | 18.9 kDa |
| Protein Sequence |
>RC202779 protein sequence
Red=Cloning site Green=Tags(s) MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGY IRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAA IDPESNSINYKDYITMMVIDEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115704 |
| RefSeq Size | 1240 |
| RefSeq ORF | 486 |
| Synonyms | CFAP200; DRC8 |
| Locus ID | 84288 |
| Cytogenetics | 1q44 |
| Summary | The gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. [provided by RefSeq, Mar 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410204 | EFCAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428415 | EFCAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410204 | Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1 |
CNY 3080.00 |
|
| LY428415 | Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 2 |
CNY 3080.00 |
|
| PH326751 | EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137415) |
CNY 14250.00 |
|
| TP302779 | Recombinant protein of human EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326751 | Purified recombinant protein of Homo sapiens EF-hand calcium binding domain 2 (EFCAB2), transcript variant 2, 20 µg |
CNY 2900.00 |
