PAM16 (NM_016069) Human Mass Spec Standard
CAT#: PH302828
TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153)
View other "PAM16" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202828 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC202828 protein sequence
Red=Cloning site Green=Tags(s) MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057153 |
RefSeq Size | 600 |
RefSeq ORF | 375 |
Synonyms | CGI-136; MAGMAS; SMDMDM; TIM16; TIMM16 |
Locus ID | 51025 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. [provided by RefSeq, May 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414208 | PAM16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414208 | Transient overexpression lysate of mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP302828 | Recombinant protein of humanmitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial, 20 µg |
CNY 2900.00 |