PAM16 (NM_016069) Human Mass Spec Standard
CAT#: PH302828
TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153)
View other "PAM16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TIMM16 MS Standard C13 and N15-labeled recombinant protein (NP_057153) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202828 |
| Predicted MW | 13.8 kDa |
| Protein Sequence |
>RC202828 protein sequence
Red=Cloning site Green=Tags(s) MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSP EEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057153 |
| RefSeq Size | 600 |
| RefSeq ORF | 375 |
| Synonyms | CGI-136; MAGMAS; SMDMDM; TIM16; TIMM16 |
| Locus ID | 51025 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes a mitochondrial protein involved in granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling. This protein also plays a role in the import of nuclear-encoded mitochondrial proteins into the mitochondrial matrix and may be important in reactive oxygen species (ROS) homeostasis. Mutations in this gene cause Megarbane-Dagher-Melike type spondylometaphyseal dysplasia, an early lethal skeletal dysplasia characterized by short stature, developmental delay and other skeletal abnormalities. [provided by RefSeq, May 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414208 | PAM16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414208 | Transient overexpression lysate of mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP302828 | Recombinant protein of humanmitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction (Magmas), nuclear gene encoding mitochondrial, 20 µg |
CNY 2900.00 |


