KIAA1191 (NM_001079685) Human Mass Spec Standard
CAT#: PH303372
KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_001073153)
View other "KIAA1191" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_001073153) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203372 |
| Predicted MW | 33.2 kDa |
| Protein Sequence |
>RC203372 protein sequence
Red=Cloning site Green=Tags(s) MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKV EEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTT EETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDS GSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVM EGKKQPPRAHNLKPRDLNVLTPTGF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001073153 |
| RefSeq Size | 2738 |
| RefSeq ORF | 915 |
| Synonyms | p33MONOX; p60MONOX |
| Locus ID | 57179 |
| Cytogenetics | 5q35.2 |
| Summary | Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412452 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421535 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421536 | KIAA1191 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412452 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 1 |
CNY 3080.00 |
|
| LY421535 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 2 |
CNY 3080.00 |
|
| LY421536 | Transient overexpression lysate of KIAA1191 (KIAA1191), transcript variant 3 |
CNY 3080.00 |
|
| PH318066 | KIAA1191 MS Standard C13 and N15-labeled recombinant protein (NP_065177) |
CNY 19520.00 |
|
| TP303372 | Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318066 | Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 1, 20 µg |
CNY 2900.00 |
其它KIAA1191产品

