COPZ2 (NM_016429) Human Mass Spec Standard
CAT#: PH304853
COPZ2 MS Standard C13 and N15-labeled recombinant protein (NP_057513)
View other "COPZ2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | COPZ2 MS Standard C13 and N15-labeled recombinant protein (NP_057513) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204853 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC204853 protein sequence
Red=Cloning site Green=Tags(s) MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLLAKYYDDTFPS MKEQMVFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRK NVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLLK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057513 |
RefSeq Size | 939 |
RefSeq ORF | 630 |
Synonyms | zeta2-COP |
Locus ID | 51226 |
Cytogenetics | 17q21.32 |
Summary | This gene encodes a member of the adaptor complexes small subunit family. The encoded protein is a subunit of the coatomer protein complex, a seven-subunit complex that functions in the formation of COPI-type, non-clathrin-coated vesicles. COPI vesicles function in the retrograde Golgi-to-ER transport of dilysine-tagged proteins. [provided by RefSeq, Feb 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414016 | COPZ2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414016 | Transient overexpression lysate of coatomer protein complex, subunit zeta 2 (COPZ2) |
CNY 3080.00 |
|
TP304853 | Recombinant protein of human coatomer protein complex, subunit zeta 2 (COPZ2), 20 µg |
CNY 2900.00 |