NPM3 (NM_006993) Human Mass Spec Standard
CAT#: PH308869
NPM3 MS Standard C13 and N15-labeled recombinant protein (NP_008924)
View other "NPM3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NPM3 MS Standard C13 and N15-labeled recombinant protein (NP_008924) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208869 |
Predicted MW | 19.3 kDa |
Protein Sequence |
>RC208869 protein sequence
Red=Cloning site Green=Tags(s) MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008924 |
RefSeq Size | 904 |
RefSeq ORF | 534 |
Synonyms | PORMIN; TMEM123 |
Locus ID | 10360 |
Cytogenetics | 10q24.32 |
Summary | The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq, Oct 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416276 | NPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416276 | Transient overexpression lysate of nucleophosmin/nucleoplasmin 3 (NPM3) |
CNY 3080.00 |
|
TP308869 | Recombinant protein of human nucleophosmin/nucleoplasmin, 3 (NPM3), 20 µg |
CNY 2900.00 |