MS4A7 (NM_206939) Human Mass Spec Standard
CAT#: PH312066
MS4A7 MS Standard C13 and N15-labeled recombinant protein (NP_996822)
View other "MS4A7" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MS4A7 MS Standard C13 and N15-labeled recombinant protein (NP_996822) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212066 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC212066 protein sequence
Red=Cloning site Green=Tags(s) MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAP YPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMV ALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQL YSNNPGSSFSSTQSQDHIQQVKKSSSRSWI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_996822 |
RefSeq Size | 2976 |
RefSeq ORF | 720 |
Synonyms | 4SPAN2; CD20L4; CFFM4; MS4A8 |
Locus ID | 58475 |
Cytogenetics | 11q12.2 |
Summary | This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404181 | MS4A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404182 | MS4A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412040 | MS4A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404181 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 2 |
CNY 3080.00 |
|
LY404182 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 3 |
CNY 3080.00 |
|
LY412040 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 1 |
CNY 3080.00 |
|
TP312066 | Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 3, 20 µg |
CNY 2900.00 |