Septin 8 (SEPT8) (NM_015146) Human Mass Spec Standard
CAT#: PH313550
SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_055961)
View other "Septin 8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_055961) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213550 |
| Predicted MW | 49.6 kDa |
| Protein Sequence |
>RC213550 representing NM_015146
Red=Cloning site Green=Tags(s) MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFE TEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRR SLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSN GVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREML IRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVN KVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQP LRKDKDKKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055961 |
| RefSeq Size | 4344 |
| RefSeq ORF | 1287 |
| Synonyms | SEP2; SEPT8 |
| Locus ID | 23176 |
| Cytogenetics | 5q31.1 |
| Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414742 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420343 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420345 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414742 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 2 |
CNY 4840.00 |
|
| LY420343 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 1 |
CNY 4840.00 |
|
| LY420345 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 4 |
CNY 3080.00 |
|
| PH316253 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092283) |
CNY 19520.00 |
|
| PH322095 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092281) |
CNY 14250.00 |
|
| TP313550 | Purified recombinant protein of Homo sapiens septin 8 (SEPT8), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP316253 | Recombinant protein of human septin 8 (SEPT8), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP322095 | Recombinant protein of human septin 8 (SEPT8), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Septin 8产品
