C20orf7 (NDUFAF5) (NM_024120) Human Mass Spec Standard
CAT＃: PH317112
C20orf7 MS Standard C13 and N15-labeled recombinant protein (NP_077025)
View other "C20orf7" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | C20orf7 MS Standard C13 and N15-labeled recombinant protein (NP_077025) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217112 |
| Predicted MW | 38.7 kDa |
| Protein Sequence |
>RC217112 representing NM_024120
Red=Cloning site Green=Tags(s) MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAARQPEPTKFDY LKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADIAENALKNSSETEIPTVSVLA DEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELRCSLQLAETEREG GFSPHISPFTAVNDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTML AAAAVYREMYRNEDGSVPATYQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_077025 |
| RefSeq Size | 1650 |
| RefSeq ORF | 1035 |
| Synonyms | bA526K24.2; C20orf7; dJ842G6.1; MC1DN16 |
| Locus ID | 79133 |
| Cytogenetics | 20p12.1 |
| Summary | The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of the mitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrial complex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411352 | NDUFAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422042 | NDUFAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411352 | Transient overexpression lysate of chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY422042 | Transient overexpression lysate of chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| TP317112 | Recombinant protein of human chromosome 20 open reading frame 7 (C20orf7), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760234 | Recombinant protein of human chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760341 | Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它C20orf7产品
