CBLN3 (NM_001039771) Human Mass Spec Standard
CAT#: PH317397
CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860)
View other "CBLN3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217397 |
Predicted MW | 21.3 kDa |
Protein Sequence |
>RC217397 representing NM_001039771
Red=Cloning site Green=Tags(s) MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPG RVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQ VSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034860 |
RefSeq Size | 2340 |
RefSeq ORF | 615 |
Synonyms | PRO1486 |
Locus ID | 643866 |
Cytogenetics | 14q12 |
Summary | Members of the precerebellin family, such as CBLN3, contain a cerebellin motif (see CBLN1; MIM 600432) and a C-terminal C1q signature domain (see MIM 120550) that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix (Pang et al., 2000 [PubMed 10964938]).[supplied by OMIM, Aug 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421824 | CBLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421824 | Transient overexpression lysate of cerebellin 3 precursor (CBLN3) |
CNY 3080.00 |
|
TP317397 | Recombinant protein of human cerebellin 3 precursor (CBLN3), 20 µg |
CNY 2900.00 |