NARF (NM_001038618) Human Mass Spec Standard
CAT＃: PH324921
NARF MS Standard C13 and N15-labeled recombinant protein (NP_001033707)
View other "NARF" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | NARF MS Standard C13 and N15-labeled recombinant protein (NP_001033707) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224921 |
| Predicted MW | 44.5 kDa |
| Protein Sequence |
>RC224921 representing NM_001038618
Red=Cloning site Green=Tags(s) MTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG VHYVFDTTIAADFSILESQKEFVRRYRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTAKSPQQ VMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKKLEALQESLPPALHGSRGADCVLTSGEIAQIMEQGDLS VRDAAVDTLFGDLKEDKVTRHDGASSDGHLAHIFRHAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEV VLRFAAAYGFRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPV RRPESSAHVQELYQEWLEGINSPKAREVLHTTYQSQERGTHSLDIKW SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001033707 |
| RefSeq Size | 1786 |
| RefSeq ORF | 1191 |
| Synonyms | IOP2 |
| Locus ID | 26502 |
| Cytogenetics | 17q25.3 |
| Summary | Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415832 | NARF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422003 | NARF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415832 | Transient overexpression lysate of nuclear prelamin A recognition factor (NARF), transcript variant 1 |
CNY 4840.00 |
|
| LY422003 | Transient overexpression lysate of nuclear prelamin A recognition factor (NARF), transcript variant 3 |
CNY 3080.00 |
|
| PH322223 | NARF MS Standard C13 and N15-labeled recombinant protein (NP_036468) |
CNY 19520.00 |
|
| TP322223 | Recombinant protein of human nuclear prelamin A recognition factor (NARF), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324921 | Recombinant protein of human nuclear prelamin A recognition factor (NARF), transcript variant 3, 20 µg |
CNY 2900.00 |
