Cytochrome b5 Outer Mitochondrial Membrane (CYB5B) (NM_030579) Human Recombinant Protein
CAT#: TP300604
Recombinant protein of human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein, 20 µg
View other "Cytochrome b5 Outer Mitochondrial Membrane" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200604 protein sequence
Red=Cloning site Green=Tags(s) MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT SESKSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_085056 |
Locus ID | 80777 |
UniProt ID | O43169 |
Refseq Size | 4286 |
Cytogenetics | 16q22.1 |
Refseq ORF | 438 |
Synonyms | CYB5-M; CYPB5M; OMB5 |
Summary | Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410783 | CYB5B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410783 | Transient overexpression lysate of cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
PH300604 | CYB5B MS Standard C13 and N15-labeled recombinant protein (NP_085056) |
CNY 19520.00 |
其它Cytochrome b5 Outer Mitochondrial Membrane产品