Adrenodoxin (FDX1) (NM_004109) Human Recombinant Protein
CAT#: TP301647
Purified recombinant protein of Homo sapiens ferredoxin 1 (FDX1), nuclear gene encoding mitochondrial protein, 20 µg
View other "Adrenodoxin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201647 protein sequence
Red=Cloning site Green=Tags(s) MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004100 |
Locus ID | 2230 |
UniProt ID | P10109 |
Refseq Size | 3155 |
Cytogenetics | 11q22.3 |
Refseq ORF | 552 |
Synonyms | ADX; FDX; LOH11CR1D |
Summary | This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401330 | FDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401330 | Transient overexpression lysate of ferredoxin 1 (FDX1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
PH301647 | FDX1 MS Standard C13 and N15-labeled recombinant protein (NP_004100) |
CNY 14250.00 |
其它Adrenodoxin产品