ALKBH7 (NM_032306) Human Recombinant Protein
CAT#: TP302583
Recombinant protein of human alkB, alkylation repair homolog 7 (E. coli) (ALKBH7), 20 µg
View other "ALKBH7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202583 protein sequence
Red=Cloning site Green=Tags(s) MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG PGESGQPPPAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115682 |
Locus ID | 84266 |
UniProt ID | Q9BT30 |
Refseq Size | 1331 |
Cytogenetics | 19p13.3 |
Refseq ORF | 663 |
Synonyms | ABH7; SPATA11; UNQ6002 |
Summary | May function as protein hydroxylase; can catalyze auto-hydroxylation at Leu-110 (in vitro), but this activity may be due to the absence of the true substrate (PubMed:25122757). Required to induce programmed necrosis in response to DNA damage caused by cytotoxic alkylating agents. Acts by triggering the collapse of mitochondrial membrane potential and loss of mitochondrial function that leads to energy depletion and cell death (PubMed:23666923). ALKBH7-mediated necrosis is probably required to prevent the accumulation of cells with DNA damage (PubMed:23666923). Does not display DNA demethylase activity (PubMed:23666923). Involved in fatty acid metabolism (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403154 | ALKBH7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403154 | Transient overexpression lysate of alkB, alkylation repair homolog 7 (E. coli) (ALKBH7) |
CNY 3080.00 |
|
PH302583 | ALKBH7 MS Standard C13 and N15-labeled recombinant protein (NP_115682) |
CNY 19520.00 |