RRAD (NM_004165) Human Recombinant Protein
CAT#: TP302927
Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2, 20 µg
View other "RRAD" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202927 representing NM_004165
Red=Cloning site Green=Tags(s) MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR FLGRIVARNSRKMAFRAKSKSCHDLSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004156 |
Locus ID | 6236 |
UniProt ID | P55042 |
Refseq Size | 1443 |
Cytogenetics | 16q22.1 |
Refseq ORF | 924 |
Synonyms | RAD; RAD1; REM3 |
Summary | May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418172 | RRAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427008 | RRAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418172 | Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 |
CNY 3080.00 |
|
LY427008 | Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 1 |
CNY 3080.00 |
|
PH302927 | RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156) |
CNY 19520.00 |
|
PH325433 | RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322) |
CNY 19520.00 |
|
TP325433 | Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1, 20 µg |
CNY 2900.00 |