FCN1 (NM_002003) Human Recombinant Protein
CAT#: TP304637
Recombinant protein of human ficolin (collagen/fibrinogen domain containing) 1 (FCN1), 20 µg
View other "FCN1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204637 protein sequence
Red=Cloning site Green=Tags(s) MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIG ERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCR PLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVD FEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWY ADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001994 |
| Locus ID | 2219 |
| UniProt ID | O00602 |
| Refseq Size | 1313 |
| Cytogenetics | 9q34.3 |
| Refseq ORF | 978 |
| Synonyms | FCNM |
| Summary | The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400731 | FCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400731 | Transient overexpression lysate of ficolin (collagen/fibrinogen domain containing) 1 (FCN1) |
CNY 3080.00 |
|
| PH304637 | FCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001994) |
CNY 19520.00 |
