CCDC68 (NM_025214) Human Recombinant Protein
CAT#: TP306244
Recombinant protein of human coiled-coil domain containing 68 (CCDC68), transcript variant 1, 20 µg
View other "CCDC68" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206244 protein sequence
Red=Cloning site Green=Tags(s) MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHC GNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQT QSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKL SLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIEN LREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079490 |
Locus ID | 80323 |
UniProt ID | Q9H2F9 |
Refseq Size | 4136 |
Cytogenetics | 18q21.2 |
Refseq ORF | 1005 |
Synonyms | SE57-1 |
Summary | Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells (PubMed:28422092). Together with CCDC120, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical subdistal appendage assembly (PubMed:28422092).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410838 | CCDC68 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428372 | CCDC68 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410838 | Transient overexpression lysate of coiled-coil domain containing 68 (CCDC68), transcript variant 1 |
CNY 3080.00 |
|
LY428372 | Transient overexpression lysate of coiled-coil domain containing 68 (CCDC68), transcript variant 2 |
CNY 3080.00 |
|
PH306244 | CCDC68 MS Standard C13 and N15-labeled recombinant protein (NP_079490) |
CNY 19520.00 |