CPA5 (NM_080385) Human Recombinant Protein
CAT#: TP307397
Recombinant protein of human carboxypeptidase A5 (CPA5), transcript variant 1, 20 µg
View other "CPA5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207397 protein sequence
Red=Cloning site Green=Tags(s) MQGTPGGGTRPGPSPVDRRTLLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLGDLEGLKPQKVDFW RGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYH TLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTA NKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGG NGSNSNPCSETYHGPSPQSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLDPVSNQRELYDLA KDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTAQET WMALRTIMEHTLNHPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_525124 |
Locus ID | 93979 |
UniProt ID | Q8WXQ8 |
Refseq Size | 2078 |
Cytogenetics | 7q32.2 |
Refseq ORF | 1308 |
Summary | Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 [PubMed 11836249]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409210 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426784 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426785 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409210 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 1 |
CNY 3080.00 |
|
LY426784 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 2 |
CNY 3080.00 |
|
LY426785 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 3 |
CNY 3080.00 |
|
PH307397 | CPA5 MS Standard C13 and N15-labeled recombinant protein (NP_525124) |
CNY 19520.00 |