TRA16 (NR2C2AP) (NM_176880) Human Recombinant Protein
CAT#: TP309320
Recombinant protein of human nuclear receptor 2C2-associated protein (NR2C2AP), 20 µg
View other "TRA16" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209320 protein sequence
Red=Cloning site Green=Tags(s) MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF SSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_795361 |
Locus ID | 126382 |
UniProt ID | Q86WQ0 |
Refseq Size | 1322 |
Cytogenetics | 19p13.11 |
Refseq ORF | 417 |
Synonyms | TRA16 |
Summary | May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406134 | NR2C2AP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406134 | Transient overexpression lysate of nuclear receptor 2C2-associated protein (NR2C2AP) |
CNY 3080.00 |
|
PH309320 | NR2C2AP MS Standard C13 and N15-labeled recombinant protein (NP_795361) |
CNY 19520.00 |