C9orf21 (AAED1) (NM_153698) Human Recombinant Protein
CAT#: TP313257
Recombinant protein of human chromosome 9 open reading frame 21 (C9orf21), 20 µg
View other "C9orf21" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213257 representing NM_153698
Red=Cloning site Green=Tags(s) MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYI CKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASS GQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLV GVQHVNFTNRPSVIHV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_714542 |
Locus ID | 195827 |
UniProt ID | Q7RTV5 |
Refseq Size | 1242 |
Cytogenetics | 9q22.33 |
Refseq ORF | 678 |
Synonyms | AAED1; C9orf21 |
Summary | May regulate positively ERK1/2 signaling and AKT1 activation leading to HIF1A up-regulation with an increased expression of glycolysis genes and enhanced glycolysis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406982 | AAED1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406982 | Transient overexpression lysate of chromosome 9 open reading frame 21 (C9orf21) |
CNY 3080.00 |
|
PH313257 | C9orf21 MS Standard C13 and N15-labeled recombinant protein (NP_714542) |
CNY 19520.00 |
其它C9orf21产品