Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein
CAT#: TP313652
Recombinant protein of human epsin 2 (EPN2), transcript variant 2, 20 µg
View other "Epsin 2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213652 representing NM_014964
Red=Cloning site Green=Tags(s) MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSPEASLCPQHRT GAPLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQL QLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQK AEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASS AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPF ESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQ PLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAA QATGTTNPFLL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 68.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055779 |
| Locus ID | 22905 |
| UniProt ID | O95208 |
| Refseq Size | 4814 |
| Cytogenetics | 17p11.2 |
| Refseq ORF | 1923 |
| Synonyms | EHB21 |
| Summary | This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407732 | EPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420185 | EPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407732 | Transient overexpression lysate of epsin 2 (EPN2), transcript variant 1 |
CNY 3080.00 |
|
| LY420185 | Transient overexpression lysate of epsin 2 (EPN2), transcript variant 3 |
CNY 3080.00 |
|
| PH310899 | EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_683723) |
CNY 19520.00 |
|
| PH313652 | EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_055779) |
CNY 19520.00 |
|
| TP310899 | Recombinant protein of human epsin 2 (EPN2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Epsin 2产品
