CEACAM19 (NM_020219) Human Recombinant Protein
CAT#: TP315862
Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2, 20 µg
View other "CEACAM19" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215862 representing NM_020219
Red=Cloning site Green=Tags(s) MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEE TYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQV AEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYLLVTRNWRGQSHRLPAPRGQGSLSILCSAVS PVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQ YQQDLLNPDPAPYCQLVPTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_064604 |
| Locus ID | 56971 |
| UniProt ID | Q7Z692 |
| Refseq Size | 1863 |
| Cytogenetics | 19q13.31 |
| Refseq ORF | 900 |
| Synonyms | CEACM19; CEAL1 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412583 | CEACAM19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426880 | CEACAM19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412583 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2 |
CNY 3080.00 |
|
| LY426880 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1 |
CNY 3080.00 |
|
| PH315862 | CEACAM19 MS Standard C13 and N15-labeled recombinant protein (NP_064604) |
CNY 19520.00 |
|
| PH325416 | CEACAM19 MS Standard C13 and N15-labeled recombinant protein (NP_001121365) |
CNY 14250.00 |
|
| TP325416 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1, 20 µg |
CNY 2900.00 |
其它CEACAM19产品
