CXorf27 (HYPM) (NM_012274) Human Recombinant Protein
CAT#: TP319889
Recombinant protein of human chromosome X open reading frame 27 (CXorf27), 20 µg
View other "CXorf27" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219889 representing NM_012274
Red=Cloning site Green=Tags(s) MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGL EASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036406 |
| Locus ID | 25763 |
| UniProt ID | O75409 |
| Refseq Size | 517 |
| Cytogenetics | Xp11.4 |
| Refseq ORF | 351 |
| Synonyms | CXorf27; HIP17; HYPM |
| Summary | This gene encodes a protein shown to interact with huntingtin, which contains an expanded polyglutamine tract in individuals with Huntington's disease (PMID: 9700202). [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415843 | HYPM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415843 | Transient overexpression lysate of chromosome X open reading frame 27 (CXorf27) |
CNY 3080.00 |
|
| PH319889 | CXorf27 MS Standard C13 and N15-labeled recombinant protein (NP_036406) |
CNY 19520.00 |
其它CXorf27产品
