S100A7L2 (NM_001045479) Human Recombinant Protein
CAT#: TP323024
Recombinant protein of human S100 calcium binding protein A7-like 2 (S100A7L2), 20 µg
View other "S100A7L2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223024 representing NM_001045479
Red=Cloning site Green=Tags(s) MLPSSGFLKAKMNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNAL EKKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001038944 |
Locus ID | 645922 |
Refseq Size | 480 |
Cytogenetics | 1q21.3 |
Refseq ORF | 336 |
Synonyms | S100a7b |
Summary | This locus is currently categorized as a non-transcribed pseudogene, but the locus type of this gene is unclear since it does contain an intact CDS. This locus lacks evidence indicating that it is transcribed, and very little of the upstream regions found in other family members are present at this locus. [provided by RefSeq, May 2018] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420753 | S100A7L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420753 | Transient overexpression lysate of S100 calcium binding protein A7-like 2 (S100A7L2) |
CNY 3080.00 |
|
PH323024 | S100A7L2 MS Standard C13 and N15-labeled recombinant protein (NP_001038944) |
CNY 19520.00 |
其它S100A7L2产品