RUNX1 (NM_001001890) Human Recombinant Protein
CAT#: TP323854
Recombinant protein of human runt-related transcription factor 1 (RUNX1), transcript variant 2, 20 µg
View other "RUNX1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223854 representing NM_001001890
Red=Cloning site Green=Tags(s) MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | RUNX1 Activity verified in a DNA-binding assay: |
| Reference Data | |
| RefSeq | NP_001001890 |
| Locus ID | 861 |
| UniProt ID | Q01196 |
| Refseq Size | 7288 |
| Cytogenetics | 21q22.12 |
| Refseq ORF | 1359 |
| Synonyms | AML1; AML1-EVI-1; AMLCR1; CBF2alpha; CBFA2; EVI-1; PEBP2aB; PEBP2alpha |
| Summary | Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Chronic myeloid leukemia, Pathways in cancer |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Hyperglycemia and redox status regulate RUNX2 DNA-binding and an angiogenic phenotype in endothelial cells
,Mochin, MT;Underwood, KF;Cooper, B;McLenithan, JC;Pierce, AD;Nalvarte, C;Arbiser, J;Karlsson, AI;Moise, AR;Moskovitz, J;Passaniti, A;,
Microvasc. Res.
,PubMed ID 25283348
[RUNX1]
|
|
Regulation of platelet myosin light chain (MYL9) by RUNX1: implications for thrombocytopenia and platelet dysfunction in RUNX1 haplodeficiency
,null,
Blood
,PubMed ID 20876458
[RUNX1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419764 | RUNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424261 | RUNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY419764 | Transient overexpression lysate of runt-related transcription factor 1 (RUNX1), transcript variant 1 |
CNY 4840.00 |
|
| LY424261 | Transient overexpression lysate of runt-related transcription factor 1 (RUNX1), transcript variant 2 |
CNY 4840.00 |
|
| PH323854 | RUNX1 MS Standard C13 and N15-labeled recombinant protein (NP_001001890) |
CNY 19520.00 |
