AKR1CL2 (AKR1E2) (NM_001040177) Human Recombinant Protein
CAT#: TP324970
Recombinant protein of human aldo-keto reductase family 1, member C-like 2 (AKR1CL2), 20 µg
View other "AKR1CL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224970 representing NM_001040177
Red=Cloning site Green=Tags(s) MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL WCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNM VIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFC QSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQV FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035267 |
Locus ID | 83592 |
UniProt ID | Q96JD6 |
Refseq Size | 1623 |
Cytogenetics | 10p15.1 |
Refseq ORF | 960 |
Synonyms | AKR1CL2; AKRDC1; htAKR; hTSP; HTSP1; LoopADR; TAKR |
Summary | The protein encoded by this gene is a member of the aldo-keto reductase superfamily. Members in this family are characterized by their structure (evolutionarily highly conserved TIM barrel) and function (NAD(P)H-dependent oxido-reduction of carbonyl groups). Transcripts of this gene have been reported in specimens of human testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421713 | AKR1E2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421713 | Transient overexpression lysate of aldo-keto reductase family 1, member E2 (AKR1E2) |
CNY 3080.00 |
|
PH324970 | AKR1E2 MS Standard C13 and N15-labeled recombinant protein (NP_001035267) |
CNY 14250.00 |
其它AKR1CL2产品