A2LD1 (GGACT) (NM_033110) Human Recombinant Protein
CAT#: TP325133
Recombinant protein of human AIG2-like domain 1 (A2LD1), 20 µg
View other "A2LD1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225133 representing NM_033110
Red=Cloning site Green=Tags(s) MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAV DERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSE GPHGLRYNPRENR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149101 |
Locus ID | 87769 |
UniProt ID | Q9BVM4 |
Cytogenetics | 13q32.3 |
Refseq ORF | 459 |
Synonyms | A2LD1 |
Summary | The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC429850 | GGACT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY429850 | Transient overexpression lysate of AIG2-like domain 1 (A2LD1) |
CNY 3080.00 |
|
PH325133 | A2LD1 MS Standard C13 and N15-labeled recombinant protein (NP_149101) |
CNY 19520.00 |
|
TP720202 | Recombinant protein of human AIG2-like domain 1 (A2LD1) |
CNY 1800.00 |