C1orf194 (NM_001122961) Human Recombinant Protein
CAT#: TP325142
Recombinant protein of human chromosome 1 open reading frame 194 (C1orf194), 20 µg
View other "C1orf194" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225142 representing NM_001122961
Red=Cloning site Green=Tags(s) MERSPSRRRRLEEAPKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNH HTGTFKNKSEILLNQKTTQDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTA ATNGGYSRKKDGGFFST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116433 |
Locus ID | 127003 |
UniProt ID | Q5T5A4 |
Cytogenetics | 1p13.3 |
Refseq ORF | 471 |
Summary | May play an important role for the maintenance of myelin-axon integrity (By similarity). May affect intracellular Ca(2+) homeostasis (PubMed:31199454).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426588 | C1orf194 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY426588 | Transient overexpression lysate of chromosome 1 open reading frame 194 (C1orf194) |
CNY 3080.00 |
|
PH325142 | C1orf194 MS Standard C13 and N15-labeled recombinant protein (NP_001116433) |
CNY 19520.00 |
其它C1orf194产品