FAM90A18 (NM_001164451) Human Recombinant Protein

CAT#: TP328382M

Purified recombinant protein of Homo sapiens family with sequence similarity 90, member A18 (FAM90A18), 100 µg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 9998.00


货期*
4周

规格
    • 100 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC228382 representing NM_001164451
Red=Cloning site Green=Tags(s)

MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP
ATLGKKEGKENLKPWKPRVEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESS
DHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADM
PQPAVRHQGREPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGL
GSNLSFGPGAKRPAQAPIQACLKFPKKPRLGPFQIPESAIQGGELGAPGNLQPPPAATELGPSTSPQMGR
RTPAQVPSVDWQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001157923
Locus ID 441326
Cytogenetics 8p23.1
Refseq ORF 1392
Synonyms FAM90A19
Summary FAM90A18 belongs to subfamily II of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 [PubMed 17684299]). For background information on the FAM90A gene family, as well as information on the evolution of FAM90A genes, see FAM90A1 (MIM 613041).[supplied by OMIM, Oct 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...