Dcun1d5 (NM_029775) Mouse Recombinant Protein
CAT#: TP502903
Purified recombinant protein of Mouse DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (Dcun1d5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202903 protein sequence
Red=Cloning site Green=Tags(s) MPVKKKRKAPGVAAAVAEDAGLKKCKIPSYCRSQPPARLISGEEDFSRKKCLAWFYEYAGPDEVVGPEGM EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQSRFDFLRSQLNDISSFKN IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD LSNYDEDGAWPVLLDEFVEWQKIRQTS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 27.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_084051 |
| Locus ID | 76863 |
| UniProt ID | Q9CXV9 |
| Refseq Size | 1201 |
| Cytogenetics | 9 A1 |
| Refseq ORF | 711 |
| Synonyms | 3110001A18Rik; 4833420K19Rik; AW060460; D430047L21Rik |
| Summary | Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Dcun1d5产品
