Nmral1 (NM_026393) Mouse Recombinant Protein

CAT#: TP504373

Purified recombinant protein of Mouse NmrA-like family domain containing 1 (Nmral1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
Rabbit Polyclonal Anti-Nmral1 Antibody
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204373 protein sequence
Red=Cloning site Green=Tags(s)

MADRKLVVVFGATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQDDAASMELALA
GAHATFIVTNYWETCSQDREVQQPHQWDQVFKQGKLLADLAKRLGLHYVVYSGLENIRKLTAGKLAAGHF
DGKGEVEEYFRDIGVPMTSVRLPCYFENLLSYFLPQKAADGKSFLLDLPMGDVPMDGMSVSDLGPVVLSL
LKKPEEYVGQNIGLSTCRHTAEEYAALLSKHTGKAVHHAKTTPEDYEKLGFQGAQDLANMFRFYTLKPDR
NIHLTLRLNPKAQTLDQWLEQHKGDFAQL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080669
Locus ID 67824
UniProt ID Q8K2T1
Refseq Size 1483
Cytogenetics 16 2.46 cM
Refseq ORF 927
Synonyms 1110025F24Rik; AI256624
Summary Redox sensor protein. Undergoes restructuring and subcellular redistribution in response to changes in intracellular NADPH/NADP(+) levels. At low NADPH concentrations the protein is found mainly as a monomer, and binds argininosuccinate synthase (ASS1), the enzyme involved in nitric oxide synthesis. Association with ASS1 impairs its activity and reduces the production of nitric oxide, which subsecuently prevents apoptosis. Under normal NADPH concentrations, the protein is found as a dimer and hides the binding site for ASS1. The homodimer binds one molecule of NADPH. Has higher affinity for NADPH than for NADP(+). Binding to NADPH is necessary to form a stable dimer (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...